Part of scaffold_955 (Scaffold)

For more information consult the page for scaffold_955 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 177 bp    Location:368088..373744   Strand:+
>bmy_14149
ATGTACTGCGTGATGCTCAAGGTGTATGAGTTGGATGTCCTGGCACCATCTGATTTCAAAACAAATCCCTCATGGTTCAACACAAATTATAAAGTCTCATCAGAGGTCACCTACTTTGTTTGCGGAGTGCTTTTTGTTCTGGTGGTAGAAGAATGGGTTTGGGAGTATGGTATTTCA

Related Sequences

bmy_14149T0 Protein

Length: 59 aa     
>bmy_14149T0
MYCVMLKVYELDVLAPSDFKTNPSWFNTNYKVSSEVTYFVCGVLFVLVVEEWVWEYGIS