Sequence detailsbmy_01530 (Coding sequence)

Part of scaffold_36 (SequenceType object (1))

For more information consult the page for scaffold_36 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

UBE2Q2 (Cow)   UBE2Q2 (Human)   Ube2q2 (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 213 bp    Location:2649880..2633220   Strand:-
Raw sequence 
>bmy_01530
ATGGAACTACTCACAAAACAGGGCTGGAGCAGTGCCTATTCAATAGAATCGGTCATCATGCAAATCAATGCCACCTTAGTCAAAGGCAAAGCCAGAGTGCAGTTTGGCGCAAATAAGAATCAATATAATCTAGCAAGAGCCCAACAGTCCTATAATTCCATTGTACAGATACATGAGAAAAATGGCTGGTACACCCCTCCAAAGGAAGATGGC

Related Sequences

bmy_01530T0 SequenceType object (3)

Length: 71 aa      
>bmy_01530T0
MELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG