Sequence details bmy_00203 (Coding sequence)

Part of scaffold_1 (Scaffold)

For more information consult the page for scaffold_1 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

TAX1BP3 ENSTTRG00000001209 (Bottlenosed dolphin)

Gene Details

Tax1 (human T-cell leukemia virus type I) binding protein 3

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000001134, Bottlenosed dolphin)

Protein Percentage 8.51%
cDNA percentage 36.88%
Ka/Ks Ratio 0.17581 (Ka = 1.4074, Ks = 8.0052)

Additional orthologs identified in other species via the OPTIC pipeline.

TAX1BP3 (Cow)   TAX1BP3 (Human)   Tax1bp3 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 144 bp    Location:4640536..4639291   Strand:-
Raw sequence 
>bmy_00203
ATGCAGGTGAACGGCTGGGACATGACCATGGTCACACACGACCAGGCCCGGAAGCGGCTCACCAAGCGCTCGGAGGAGGTGGTGCGTCTGCTGGTGACGCGGCAGTCGCTGCAGAAGGCCGTGCAGCAGTCCATGCTGTCCTAG

Related Sequences

bmy_00203T0 Protein

Length: 48 aa      
>bmy_00203T0
MQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS*